All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (925)
- (1,939)
- (4,412)
- (1)
- (1)
- (3)
- (1)
- (1,258)
- (1,754)
- (921,451)
- (21,592)
- (2)
- (774)
- (61)
- (1)
- (29)
- (1)
- (5,588)
- (3,360)
- (1,862)
- (218)
- (1)
- (8,787)
- (12,059)
- (2,271)
- (9)
- (51)
- (3)
- (4)
- (13)
- (2)
- (69)
- (5)
- (11)
- (12,287)
- (15,867)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,669)
- (535)
- (1)
- (1)
- (136)
- (422)
- (3)
- (1)
- (3)
- (16)
- (110)
- (1)
- (189,975)
- (288,095)
- (1)
- (19)
- (798)
- (1)
- (12,212)
- (2)
- (129)
- (1)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (12)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (19)
- (46)
- (1)
- (5)
- (1)
- (1)
- (10,751)
- (652)
- (1)
- (2)
- (1)
- (4)
- (6)
- (6)
- (1)
- (8)
- (3)
- (16)
- (2)
- (2)
- (329)
- (359)
- (5)
- (12,996)
- (2)
- (4,300)
- (2,250)
- (1)
- (14)
- (33)
- (1)
- (7)
- (1)
- (6,036)
- (3,901)
- (1)
- (20)
- (1)
- (1)
- (2)
- (40)
- (1)
- (2)
- (1)
- (17,537)
- (16,763)
- (18)
- (1)
- (1)
- (1)
- (5,545)
- (2)
- (2)
- (43)
- (4)
- (13)
- (1)
- (164)
- (748)
- (17)
- (2)
- (6)
- (1)
- (1)
- (2)
- (2,085)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (6)
- (2)
- (2)
- (104)
- (1)
- (1)
- (3,862)
- (2)
- (20)
- (3)
- (112)
- (1)
- (1)
- (5)
- (2)
- (3)
- (33)
- (1)
- (5)
- (187)
- (2)
- (4,823)
- (12)
- (1)
- (2)
- (5)
- (9)
- (4)
- (7)
- (23)
- (130)
- (8,929)
- (39,658)
- (448)
- (53)
- (1,929)
- (1)
- (36)
- (7)
- (1)
- (2,681)
- (1)
- (4,476)
- (42)
- (2)
- (2)
- (1)
- (1)
- (4)
- (50)
- (1)
- (1)
- (815)
- (1)
- (1)
- (2)
- (2)
- (32)
- (40)
- (4)
- (6)
- (3)
- (6)
- (1)
- (3)
- (1)
- (3)
- (3)
- (31,160)
- (9)
- (1)
- (29)
- (2,893)
- (74)
- (89)
- (275)
- (2)
- (55)
- (29,965)
- (29,827)
- (6)
- (32,469)
- (16)
- (29,774)
- (45)
- (866)
- (48)
- (595)
- (30,794)
- (1)
- (32,527)
- (1)
- (3)
- (1)
- (73)
- (3)
- (30,317)
- (29,972)
- (3)
- (24,399)
- (24,961)
- (24,935)
- (24,831)
- (24,992)
- (24,794)
- (23)
- (127)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (34,906)
- (11)
- (3)
- (221)
- (761)
- (1,054)
- (721)
- (777)
- (920)
- (889)
- (1,009)
- (850)
- (1,470)
- (910)
- (835)
- (1,058)
- (1,059)
- (1,056)
- (681)
- (1,087)
- (30,490)
- (90)
- (9)
- (42)
- (17)
- (1)
- (103)
- (1)
- (139)
- (3)
- (79)
- (28,930)
- (28,983)
- (29,280)
- (63)
- (28,999)
- (25,597)
- (1)
- (60)
- (28,922)
- (28,575)
- (28,539)
- (17)
- (9)
- (1)
- (1)
- (7)
- (4)
- (33,652)
- (5)
- (30)
- (1)
- (1)
- (338)
- (734)
- (30,825)
- (1)
- (30,923)
- (27,238)
- (17,685)
- (17,678)
- (27,221)
- (30,927)
- (38)
- (1)
- (47)
- (9)
- (13)
- (2)
- (99)
- (11)
- (22)
- (58)
- (26)
- (127)
- (158)
- (25)
- (84)
- (58)
- (24)
- (56)
- (75)
- (9)
- (65)
- (73)
- (95)
- (84)
- (78)
- (28)
- (64)
- (70)
- (44)
- (58)
- (50)
- (53)
- (98)
- (122)
- (41)
- (58)
- (65)
- (77)
- (75)
- (454)
- (32,846)
- (7)
- (4)
- (311)
- (417)
- (2,778)
- (3,757)
- (24)
- (3)
- (37)
- (214)
- (2,662)
- (155)
- (41)
- (27,786)
- (558)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (858)
- (142)
- (536)
- (429)
- (878)
- (402)
- (325)
- (815)
- (756)
- (721)
- (2)
- (630)
- (722)
- (290)
- (752)
- (822)
- (634)
- (807)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (11)
- (6)
- (5)
- (9)
- (3)
- (8)
- (2)
- (56)
- (14)
- (542,540)
- (7)
- (266)
- (49)
- (2)
- (367)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,993)
- (30,024)
- (29,977)
- (562)
- (2,894)
- (51)
- (1)
- (15)
- (1,780)
- (726)
- (3)
- (2)
- (6)
- (4)
- (5)
- (111,671)
- (68)
- (123)
- (2,111)
- (31,219)
- (221)
- (8)
- (23)
- (597,667)
- (16)
- (1)
- (800,199)
- (84,194)
- (3)
- (45,149)
- (174)
- (1)
- (1)
- (571)
- (2)
- (36)
- (23)
- (187)
- (1,232)
- (3)
- (4)
- (468)
- (98)
- (1)
- (1,429)
- (3)
- (2)
- (7)
- (2)
- (127)
- (2)
- (9)
- (95)
- (164)
- (51)
- (745)
- (5)
- (8,432)
- (7,041)
- (12)
- (2)
- (1)
- (27)
- (27)
- (6)
- (161)
- (292)
- (1)
- (74)
- (2)
- (10,238)
- (43)
- (425)
- (171)
- (2,277)
- (156)
- (6)
- (348)
- (2)
- (1)
- (120)
- (1)
- (9)
- (10)
- (27)
- (84)
- (2)
- (23)
- (1)
- (677)
- (56)
- (8)
- (21)
- (109,131)
- (2)
- (2)
- (57)
- (70)
- (275)
- (18)
- (1,253)
- (6,085)
- (2)
- (7)
- (2)
- (2,152)
- (6)
- (57)
- (432,679)
- (31)
- (20,758)
- (15,649)
- (1,535)
- (377)
- (219)
- (79)
- (10,492)
- (4)
- (170)
- (28)
- (2)
- (28)
- (25)
- (1,047)
- (7)
- (2)
- (9)
- (18)
- (2)
- (1)
- (2)
- (92)
- (10)
- (2)
- (349,480)
- (2,675)
- (43,521)
- (93)
- (2)
- (50)
- (41)
- (1)
- (1)
- (4)
- (167)
- (2)
- (32,406)
- (127)
- (2)
- (1)
- (2)
- (150)
- (893)
- (15,271)
- (3)
- (2)
- (168)
- (30)
- (2)
- (2)
- (10)
- (819)
- (3)
- (2)
- (2)
- (2)
- (2)
- (10)
- (87)
- (64)
- (3)
- (337)
- (1,422)
- (2,837)
- (4)
- (290,166)
- (153,811)
- (191)
- (53)
- (197,228)
- (502,584)
- (77)
- (1,445)
- (43,004)
- (14)
- (267)
- (12,831)
- (529,517)
- (202)
- (609)
- (2)
- (3)
- (551)
- (6)
- (4)
- (211,654)
- (2,647)
- (27)
- (10)
- (51)
- (526)
- (25)
- (270)
- (1,156)
- (1,424)
- (7)
- (8)
- (1,339)
- (4)
- (2)
- (3)
- (25)
- (6,535)
- (1)
- (6)
- (813)
- (32)
- (9)
- (2)
- (434)
- (4)
- (4)
- (2)
- (22)
- (48)
- (1,208)
- (2)
- (16)
- (1,835)
- (1)
- (4)
- (2)
- (261)
- (437)
- (1,279)
- (39)
- (6)
- (43,436)
- (22)
- (1)
- (917)
- (85)
- (835)
- (1,910)
- (5)
- (2)
- (3)
- (2)
- (2)
- (22,381)
- (10)
- (1)
- (4)
- (1,390)
- (9)
- (2)
- (4)
- (135)
- (2)
- (1)
- (2,798)
- (105)
- (3)
- (13)
- (33)
- (1,513)
- (5)
- (2)
- (9,778)
- (4,867)
- (3,679)
- (1)
- (41)
- (11)
- (4,367)
- (2)
- (460)
- (442)
- (4)
- (26)
- (14)
- (52)
- (14)
- (2,634)
- (258)
- (3)
- (1)
- (1)
- (29)
- (13)
- (39)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1,080,854)
- (3)
- (9,440)
- (19)
- (1)
- (51)
- (10)
- (74)
- (3)
- (3)
- (90)
- (40)
- (106)
- (494)
- (5)
- (728)
- (150)
- (62)
- (882)
- (8)
- (35)
- (8)
- (22)
- (5)
- (4)
- (2)
- (867)
- (2)
- (2,269)
- (51)
- (2)
- (5,098)
- (436)
- (1)
- (4)
- (24)
- (3)
- (4)
- (4)
- (8)
- (1)
- (2)
- (19,897)
- (1,027)
- (2,074)
- (426)
- (62)
- (1,190)
- (4)
- (9)
- (53)
- (9)
- (4)
- (47)
- (8)
- (29,697)
- (821)
- (2)
- (2)
- (4)
- (8)
- (5)
- (1,305)
- (9,923)
- (376)
- (1,447)
- (20)
- (855)
- (4)
- (2)
- (30)
- (2)
- (1)
- (1,022)
- (3)
- (9)
- (1)
- (18)
- (3)
- (2)
- (1,266)
- (3,505)
- (371)
- (2)
- (42)
- (5)
- (3)
- (4)
- (3)
- (6)
- (1,889)
- (12)
- (39)
- (4)
- (2,383)
- (164)
- (135)
- (50)
- (1,477)
- (263)
- (2)
- (14)
- (18)
- (1)
- (21)
- (4,674)
- (173)
- (44)
- (1)
- (2)
- (2)
- (5,218)
- (68)
- (578)
- (300)
- (3)
- (108)
- (1)
- (1,572)
- (43)
- (4)
- (2)
- (9)
- (497)
- (21)
- (352)
- (3)
- (3)
- (6)
- (149)
- (145)
- (1)
- (1,779)
- (126)
- (168)
- (42)
- (3)
- (2)
- (176)
- (1)
- (2)
- (36)
- (3,494)
- (218)
- (407)
- (1)
- (274)
- (240)
- (236)
- (160)
- (9)
- (15)
- (11)
- (5)
- (5,223)
- (308)
- (6)
- (10)
- (1)
- (4)
- (52)
- (23)
- (73)
- (2)
- (28)
- (709)
- (1,433,637)
- (695)
- (9)
- (19)
- (1)
- (5)
- (78)
- (519)
- (89)
- (57)
- (15)
- (80)
- (42)
- (441)
- (524)
- (3)
- (15)
- (4)
- (17)
- (107)
- (9)
- (17)
- (2)
- (24)
- (1)
- (24)
- (2)
- (2)
- (16)
- (59)
- (2)
- (18)
- (2)
- (496)
- (8)
- (1)
- (890)
- (1,201)
- (2)
- (8)
- (4)
- (59)
- (139)
- (4)
- (268)
- (1)
- (13)
- (23,996)
- (90)
- (8)
- (2)
- (3)
- (1)
- (571,346)
- (4,877)
- (1,533)
- (1)
- (254)
- (2)
- (3)
- (30)
- (28)
- (8)
- (798)
- (7,443)
- (5)
- (4)
- (46)
- (1,310)
- (23)
- (279)
- (113)
- (1)
- (143)
- (182)
- (1)
- (3)
- (13)
- (20)
- (62)
- (5)
- (6)
- (9)
- (17)
- (207)
- (18)
- (18,491)
- (545)
- (215)
- (25)
- (1,234)
- (6)
- (1)
- (3)
- (1)
- (3)
- (124)
- (11)
- (5)
- (14,722)
- (155)
- (401)
- (10)
- (4)
- (6)
- (62)
- (10,252)
- (532)
- (4)
- (10)
- (2)
- (338,661)
- (5,177)
- (2)
- (6)
- (399)
- (2)
- (33)
- (2,777)
- (1,119)
- (3)
- (10)
- (30)
- (65)
- (153)
- (57)
- (2)
- (247)
- (31)
- (36)
- (3)
- (951)
- (2)
- (5,182)
- (2)
- (1)
- (15)
- (2)
- (22)
- (1)
- (1)
- (2)
- (13)
- (1)
- (2)
- (1)
- (13)
- (3,894)
- (471)
- (1)
- (2)
- (19)
- (5)
- (6)
- (3)
- (9)
- (54)
- (8)
- (3)
- (1)
- (4)
- (87)
- (10)
- (2)
- (24)
- (2)
- (2)
- (42)
- (3)
- (2)
- (2)
- (23)
- (82)
- (2,574)
- (1)
- (8)
- (23)
- (2)
- (3)
- (1,402)
- (6)
- (22)
- (13)
- (4)
- (4)
- (202)
- (5)
- (1,337)
- (38)
- (6)
- (3)
- (19,928)
- (2)
- (50)
- (2)
- (5)
- (3)
- (148)
- (339)
- (183)
- (2,287)
- (1,820)
- (30)
- (16)
- (2)
- (2)
- (4,513)
- (5)
- (9)
Filtered Search Results
Invitrogen™ CD217 (IL-17Ra) Monoclonal Antibody (424LTS), PerCP-eFluor™ 710, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | PerCP-eFluor 710 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | Q96F46 |
| Isotype | IgG1 κ |
| Concentration | 5 μL/Test |
| Antigen | CD217 (IL-17Ra) |
| Gene Symbols | Il17ra |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AW538159; CANDF5; CD127; CD217; CDw217; hIL-17R; IL-17 receptor A; IL17R; Il17ra; IL-17RA; interleukin 17 receptor A; interleukin-17 receptor A; MGC10262; VDw217 |
| Gene | Il17ra |
| Product Type | Antibody |
| Gene ID (Entrez) | 23765 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 424LTS |
CD39 Monoclonal Antibody (eBioA1 (A1)), APC-eFluor™ 780, eBioscience™, Invitrogen™
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | APC-eFluor 780 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | P49961 |
| Concentration | 5 μL/Test |
| Antigen | CD39 |
| Gene Symbols | ENTPD1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene | ENTPD1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 953 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | eBioA1 (A1) |
CD11c Monoclonal Antibody (N418), Alexa Fluor™ 700, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Armenian Hamster Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Armenian Hamster |
| Conjugate | Alexa Fluor 700 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG |
| Gene Accession No. | Q9QXH4 |
| Concentration | 0.2 mg/mL |
| Antigen | CD11c |
| Gene Symbols | Itgax |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AI449405; CD11 antigen-like family member C; CD11c; CD11C (p150) alpha polypeptide; complement component 3 receptor 4 subunit; complement receptor 4; Cr4; integrin alpha X; integrin alpha-X; integrin aX; integrin subunit alpha X; integrin, alpha X; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin, alpha X (complement component 3 receptor 4 subunit); Itgax; Leu M5; leu M5, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; Leukocyte adhesion receptor p150,95; leukocyte surface antigen p150,95, alpha subunit; myeloid membrane antigen, alpha subunit; N418; p150 95 integrin alpha chain; RGD1561123; SLEB6 |
| Gene | Itgax |
| Product Type | Antibody |
| Gene ID (Entrez) | 16411 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | N418 |
SSEA3 Monoclonal Antibody (eBioMC-631 (MC-631)), Alexa Fluor™ 488, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rat |
| Conjugate | Alexa Fluor 488 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgM |
| Concentration | 5 μL/Test |
| Antigen | SSEA3 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | SSEA-3; stage-specific embryonic antigen 3 |
| Product Type | Antibody |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | eBioMC-631 (MC-631) |
Invitrogen™ TNF alpha Monoclonal Antibody (MAb11), Alexa Fluor™ 488, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Alexa Fluor 488 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P01375 |
| Isotype | IgG1 κ |
| Concentration | 5 μL/Test |
| Antigen | TNF alpha |
| Gene Symbols | Tnf |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | APC1 protein; Cachectin; C-domain 1; C-domain 2; cTNF; DADB-70P7.1; DIF; ICD1; ICD2; Intracellular domain 1; Intracellular domain 2; N-terminal fragment; NTF; RATTNF; Tnf; TNF alpha; TNF superfamily; TNF α; TNF, macrophage-derived; TNF, monocyte-derived; TNFA; TNF-a; TNFalpha; TNF-alpha; Tnfsf1a; TNFSF2; TNFα; TNLG1F; Tumor necrosis factor; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor alpha; tumor necrosis factor alpha (cachetin); tumor necrosis factor alpha precursor; tumor necrosis factor ligand 1F; tumor necrosis factor ligand superfamily member 2; Tumor necrosis factor, membrane form; Tumor necrosis factor, soluble form; tumor necrosis factor-alpha; tumor necrosis factor-alpha precursor; tumor-necrosis factor; tumour necrosis factor |
| Gene | Tnf |
| Product Type | Antibody |
| Gene ID (Entrez) | 7124 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | MAb11 |
Invitrogen™ CD38 Monoclonal Antibody (90), Alexa Fluor™ 700, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | Alexa Fluor 700 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P56528 |
| Isotype | IgG2a κ |
| Concentration | 0.2 mg/mL |
| Antigen | CD38 |
| Gene Symbols | CD38 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 2'-phospho-ADP-ribosyl cyclase; 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase; 2'-phospho-cyclic-ADP-ribose transferase; ADPRC 1; ADPRC1; ADP-ribosyl cyclase 1; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1; cADPr hydrolase 1; Cd38; CD38 antigen; CD38 antigen (ADP-ribosyl cyclase / cyclic ADP-ribose hydrolase); CD38 antigen (p45); CD38 antigen p45; CD38 molecule; CD38H; Cd38-rs1; cluster of differentiation 38; cyclic ADP-ribose hydrolase 1; ecto-nicotinamide adenine dinucleotide glycohydrolase; I-19; NAD(+) nucleosidase; NAD+ nucleosidase; NIM-R5 antigen; T10 |
| Gene | CD38 |
| Product Type | Antibody |
| Gene ID (Entrez) | 12494 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 90 |
Invitrogen™ CXCL13 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Goat Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human |
| Host Species | Goat |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Neutralization,Western Blot |
| Form | Lyophilized |
| Gene Accession No. | O43927 |
| Isotype | IgG |
| Concentration | 0.2 mg/mL |
| Antigen | CXCL13 |
| Gene Symbols | Cxcl13 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | 4631412M08Rik; Angie; ANGIE2; B cell-attracting chemokine 1; b lymphocyte chemoattractant; BCA1; BCA-1; B-cell chemoattractant; B-cell-attracting chemokine 1; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); BLC; BLR1L; B-lymphocyte chemoattractant; C Cmotif chemokine; C X C motif chemokine; CC motif chemokine; CCmotif chemokine; chem; chemokine (C-X-C motif) ligand 13; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); CXC; CXC chemokine BLC; CXC motif chemokine; CXC motif chemokine 13; C-X-C motif chemokine 13; C-X-C motif chemokine ligand 13; CXCL; Cxcl13; SCYB13; small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); small inducible cytokine subfamily B (Cys-X-Cys), member 13; small-inducible cytokine B13 |
| Gene | Cxcl13 |
| Product Type | Antibody |
| Gene ID (Entrez) | 10563 |
| Formulation | PBS with 5% trehalose and No Preservative |
| Immunogen | E. coli-derived recombinant human CXCL13/BCA-1 Val23-Arg94. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ CD163 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | Q86VB7 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | CD163 |
| Gene Symbols | CD163 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | CD163; CD163 antigen; CD163 molecule; CD163v2; CD163v3; Hemoglobin scavenger receptor; M130; macrophage-associated antigen; MM130; putative CD163 antigen; SCARI1; Scavenger receptor cysteine-rich type 1 protein M130; sCD163; Soluble CD163; Soluble sCD163 |
| Gene | CD163 |
| Product Type | Antibody |
| Gene ID (Entrez) | 9332 |
| Formulation | PBS with 4mg trehalose and 0.05mg sodium azide |
| Immunogen | E. coli-derived human CD163 recombinant protein (Position: T47-E201). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Cyclin T1 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O60563 |
| Isotype | IgG |
| Concentration | 1.0 mg/mL |
| Antigen | Cyclin T1 |
| Gene Symbols | Ccnt1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | 2810478G24Rik; AI115585; CCNT; CCNT1; CDK9-associated C-type protein; cyclin C-related protein; cyclin T1; cyclin T1b; cyclin-T; cyclin-T1; CycT1; HIVE1; human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1 |
| Gene | Ccnt1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 315291, 904 |
| Formulation | PBS with 20% glycerol and 0.025% ProClin 300; pH 7 |
| Immunogen | Recombinant protein encompassing a sequence within the center region of human Cyclin T1. The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ NLRP3 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Western Blot |
| Form | Lyophilized |
| Gene Accession No. | D4A523, Q8R4B8, Q96P20 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | NLRP3 |
| Gene Symbols | NLRP3 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | AGTAVPRL; AII; AII/AVP; Angiotensin/vasopressin receptor AII/AVP-like; AVP; C1orf7; caterpiller protein 1.1; Cias1; CLR1.1; cold autoinflammatory syndrome 1 homolog; cold autoinflammatory syndrome 1 protein; cold autoinflammatory syndrome 1 protein homolog; Cold-induced autoinflammatory syndrome 1 protein; cryopyrin; FCAS; FCAS1; FCU; FLJ95925; mast cell maturation inducible protein 1; mast cell maturation-associated-inducible protein 1; Mmig1; MWS; NACHT domain-, leucine-rich repeat-, and PYD-containing protein 3; NACHT, LRR and PYD containing protein 3; NACHT, LRR and PYD domains-containing protein 3; NACHT/LRR/pyrin domain-containing protein 3; NALP3; NLR family pyrin domain containing 3; NLR family, pyrin domain containing 3; Nlrp3; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 3; PYPAF1; PYRIN-containing APAF1-like protein 1 |
| Gene | NLRP3 |
| Product Type | Antibody |
| Gene ID (Entrez) | 114548, 216799, 287362 |
| Formulation | PBS with 4mg trehalose and no preservative |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human CIAS1 (12-31aa RYLEDLEDVDLKKFKMHLED). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ CD206 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot |
| Form | Liquid |
| Gene Accession No. | P22897 |
| Isotype | IgG |
| Concentration | 0.10 mg/mL |
| Antigen | CD206 |
| Gene Symbols | Mrc1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | AW259686; bA541I19.1; CD206; CELE_Y39A3CR.4; CLEC13D; CLEC13DL; C-type lectin domain family 13 member D; C-type lectin domain family 13 member D-like; ddp-1; hMR; Human mannose receptor; macrophage mannose receptor 1; Macrophage mannose receptor 1-like protein 1; mannose receptor, C type 1; mannose receptor, C type 1-like 1; Mitochondrial import inner membrane translocase subunit Tim8; MMR; MR; MRC1; MRC1L1; tim-8; Y39A3CR.4 |
| Gene | Mrc1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 4360 |
| Formulation | PBS with 40% glycerol and 0.02% sodium azide; pH 7.2 |
| Immunogen | Recombinant protein corresponding to Human MRC1. Recombinant protein control fragment (Product #RP-101913). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ NTCP Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | O08705, P26435 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | NTCP |
| Gene Symbols | SLC10A1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | bile acid cotransporting polypeptide; cell growth-inhibiting gene 29 protein; GIG29; growth-inhibiting protein 29; hepatic sodium-dependent bile acid transporter; LOW QUALITY PROTEIN: sodium/bile acid cotransporter; MGC128766 protein; Na(+)/bile acid cotransporter; Na(+)/taurocholate transport protein; Na/taurocholate cotransporting polypeptide; NA-dependent cholate transporting protein; Ntcp; Ntcp1; SBACT; Slc10a1; sodium bile acid cotransporting polypeptide; sodium/bile acid cotransporter; sodium/tauro; sodium/taurocholate cotransporter; sodium/taurocholate cotransporting polypeptide; sodium-dependent bile acid cotransporter; sodium-dependent taurocholate cotransporting polypeptide; sodium-taurocholate cotransporting polypeptide; solute carrier family 10 (sodium/bile acid cotransporter family), member 1; solute carrier family 10 (sodium/bile acid cotransporter), member 1; solute carrier family 10 member 1; solute carrier family 10, member 1 |
| Gene | SLC10A1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 20493, 24777 |
| Formulation | PBS with 4mg trehalose and no preservative |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Phospho-KCC2 (Thr1007) Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Liquid |
| Gene Accession No. | Q63633, Q91V14 |
| Isotype | IgG |
| Concentration | 0.25 mg/mL |
| Antigen | Phospho-KCC2 (Thr1007) |
| Gene Symbols | SLC12A5 |
| Regulatory Status | RUO |
| Purification Method | Antigen Affinity Chromatography |
| Gene Alias | EIEE34; EIG14; Electroneutral potassium-chloride cotransporter 2; erythroid K-Cl cotransporter 2; furosemide-sensitive K-Cl cotransporter; hKCC2; KCC 2; Kcc2; KCC2a variant 1; KCC2a-S25 variant 1; KCC2b variant 2; K-Cl cotransporter 2; KIAA1176; mKCC2; mKIAA1176; neuronal K-Cl cotransporter; neuronal-specific K-Cl cotransporter; rKCC2; S12A5; SLC12A5; solute carrier family 12 (potassium/chloride transporter), member 5; solute carrier family 12 (potassium-chloride transporter), member 5; solute carrier family 12 member 5; solute carrier family 12, (potassium-chloride transporter) member 5; solute carrier family 12, member 5 |
| Gene | SLC12A5 |
| Product Type | Antibody |
| Gene ID (Entrez) | 171373, 57138 |
| Formulation | 10mM HEPES with 100μg/mL BSA, 50% glycerol, 0.15M NaCl and no preservative; pH 7.5 |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr1007 of rat KCC2 conjugated to KLH. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Insulin Monoclonal Antibody (7F8)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Bovine,Pig |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA |
| Form | Liquid |
| Gene Accession No. | P01308, P01315, P01317 |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | Insulin |
| Gene Symbols | INS |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | AA986540; IDDM; IDDM1; IDDM2; ILPR; INS; Ins1; Ins-1; Ins2; Ins-2; Ins2-rs1; InsII; Insulin; insulin 1; insulin 2; Insulin A chain; Insulin B chain; insulin I; insulin II; insulin-1; Insulin-1 A chain; Insulin-1 B chain; Insulin-2; Insulin-2 A chain; Insulin-2 B chain; IRDN; Mody; MODY10; Mody4; preproinsulin; proinsulin |
| Gene | INS |
| Product Type | Antibody |
| Gene ID (Entrez) | 280829, 3630, 397415 |
| Formulation | PBS with 0.1% sodium azide; pH 7.4 |
| Immunogen | Purified human Insulin. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 7F8 |
CD162 (PSGL-1) Monoclonal Antibody (4RA10), PE, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | PE |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | Q62170 |
| Concentration | 0.2 mg/mL |
| Antigen | CD162 (PSGL-1) |
| Gene Symbols | SELPLG |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | CD162; CLA; Cutaneous lymphocyte associated antigen; cutaneous lymphocyte-associated associated antigen; leukocyte cell surface adhesion molecule; P-selectin glycoprotein ligand 1; P-selectin glycoprotein ligand 1 propeptide; P-selectin glycoprotein ligand-1; Psgl1; Psgl-1; Selectin P ligand; selectin, platelet (p-selectin) ligand; Selp1; SELPG; Selpl; SELPLG |
| Gene | SELPLG |
| Product Type | Antibody |
| Gene ID (Entrez) | 20345 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Immunogen | Mouse PSGL-1 human IgG1 fusion protein. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 4RA10 |